Placeholder image of a protein
Icon representing a puzzle

1139: Revisiting Puzzle 91: Virus Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 15, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Firebirds BioChem 21. Firebirds BioChem 1 pt. 6,423
  2. Avatar for DIE-CINVESTAV 22. DIE-CINVESTAV 1 pt. 5,707
  3. Avatar for Russian team 23. Russian team 1 pt. 3,306

  1. Avatar for smholst 91. smholst Lv 1 14 pts. 8,502
  2. Avatar for caglar 92. caglar Lv 1 14 pts. 8,479
  3. Avatar for bamh 93. bamh Lv 1 13 pts. 8,473
  4. Avatar for Soggy Doglog 94. Soggy Doglog Lv 1 13 pts. 8,472
  5. Avatar for Truncheon Luncheon 95. Truncheon Luncheon Lv 1 13 pts. 8,439
  6. Avatar for petetrig 96. petetrig Lv 1 12 pts. 8,431
  7. Avatar for guineapig 97. guineapig Lv 1 12 pts. 8,414
  8. Avatar for YeshuaLives 98. YeshuaLives Lv 1 12 pts. 8,408
  9. Avatar for Mydogisa Toelicker 99. Mydogisa Toelicker Lv 1 11 pts. 8,402
  10. Avatar for NameChangeNeeded01 100. NameChangeNeeded01 Lv 1 11 pts. 8,388

Comments