Placeholder image of a protein
Icon representing a puzzle

1139: Revisiting Puzzle 91: Virus Protein

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
September 15, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Firebirds BioChem 21. Firebirds BioChem 1 pt. 6,423
  2. Avatar for DIE-CINVESTAV 22. DIE-CINVESTAV 1 pt. 5,707
  3. Avatar for Russian team 23. Russian team 1 pt. 3,306

  1. Avatar for pizpot 111. pizpot Lv 1 8 pts. 8,297
  2. Avatar for Vincenzo Brancaccio 112. Vincenzo Brancaccio Lv 1 8 pts. 8,296
  3. Avatar for Exonx 113. Exonx Lv 1 8 pts. 8,280
  4. Avatar for WBarme1234 114. WBarme1234 Lv 1 8 pts. 8,269
  5. Avatar for PrettyPony2001 115. PrettyPony2001 Lv 1 7 pts. 8,254
  6. Avatar for Mike Cassidy 116. Mike Cassidy Lv 1 7 pts. 8,244
  7. Avatar for SouperGenious 117. SouperGenious Lv 1 7 pts. 8,227
  8. Avatar for jamiexq 118. jamiexq Lv 1 7 pts. 8,225
  9. Avatar for JUMELLE54 119. JUMELLE54 Lv 1 6 pts. 8,218
  10. Avatar for gdnskye 120. gdnskye Lv 1 6 pts. 8,183

Comments