Placeholder image of a protein
Icon representing a puzzle

1139: Revisiting Puzzle 91: Virus Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 15, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Firebirds BioChem 21. Firebirds BioChem 1 pt. 6,423
  2. Avatar for DIE-CINVESTAV 22. DIE-CINVESTAV 1 pt. 5,707
  3. Avatar for Russian team 23. Russian team 1 pt. 3,306

  1. Avatar for dahast.de 121. dahast.de Lv 1 6 pts. 8,182
  2. Avatar for arginia 122. arginia Lv 1 6 pts. 8,179
  3. Avatar for senor pit 123. senor pit Lv 1 6 pts. 8,174
  4. Avatar for ManVsYard 124. ManVsYard Lv 1 6 pts. 8,172
  5. Avatar for actin19 125. actin19 Lv 1 5 pts. 8,160
  6. Avatar for MaartenDesnouck 126. MaartenDesnouck Lv 1 5 pts. 8,159
  7. Avatar for adamsuperktos 127. adamsuperktos Lv 1 5 pts. 8,158
  8. Avatar for Iron pet 128. Iron pet Lv 1 5 pts. 8,142
  9. Avatar for Hiro Protagonist 129. Hiro Protagonist Lv 1 5 pts. 8,135
  10. Avatar for brgreening 130. brgreening Lv 1 5 pts. 8,125

Comments