Placeholder image of a protein
Icon representing a puzzle

1139: Revisiting Puzzle 91: Virus Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 15, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Firebirds BioChem 21. Firebirds BioChem 1 pt. 6,423
  2. Avatar for DIE-CINVESTAV 22. DIE-CINVESTAV 1 pt. 5,707
  3. Avatar for Russian team 23. Russian team 1 pt. 3,306

  1. Avatar for Auntecedent 141. Auntecedent Lv 1 3 pts. 7,938
  2. Avatar for leehaggis 142. leehaggis Lv 1 3 pts. 7,918
  3. Avatar for RyeSnake 143. RyeSnake Lv 1 3 pts. 7,913
  4. Avatar for ViJay7019 144. ViJay7019 Lv 1 3 pts. 7,904
  5. Avatar for navn 145. navn Lv 1 3 pts. 7,891
  6. Avatar for PlagueRat 146. PlagueRat Lv 1 3 pts. 7,888
  7. Avatar for SWR_DMaster 147. SWR_DMaster Lv 1 3 pts. 7,885
  8. Avatar for Reldas 148. Reldas Lv 1 3 pts. 7,883
  9. Avatar for pfirth 149. pfirth Lv 1 3 pts. 7,868
  10. Avatar for TurboGamer1 150. TurboGamer1 Lv 1 2 pts. 7,842

Comments