Placeholder image of a protein
Icon representing a puzzle

1139: Revisiting Puzzle 91: Virus Protein

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
September 15, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Firebirds BioChem 21. Firebirds BioChem 1 pt. 6,423
  2. Avatar for DIE-CINVESTAV 22. DIE-CINVESTAV 1 pt. 5,707
  3. Avatar for Russian team 23. Russian team 1 pt. 3,306

  1. Avatar for F234 161. F234 Lv 1 2 pts. 7,694
  2. Avatar for Inkedhands 162. Inkedhands Lv 1 2 pts. 7,676
  3. Avatar for jebbiek 163. jebbiek Lv 1 2 pts. 7,666
  4. Avatar for multaq 164. multaq Lv 1 2 pts. 7,617
  5. Avatar for Jajaboman 165. Jajaboman Lv 1 2 pts. 7,608
  6. Avatar for martinf 166. martinf Lv 1 1 pt. 7,606
  7. Avatar for rokenbok411 167. rokenbok411 Lv 1 1 pt. 7,592
  8. Avatar for ChinaSESsolve 168. ChinaSESsolve Lv 1 1 pt. 7,591
  9. Avatar for DerpDragon 169. DerpDragon Lv 1 1 pt. 7,576
  10. Avatar for carmel4a 170. carmel4a Lv 1 1 pt. 7,575

Comments