Placeholder image of a protein
Icon representing a puzzle

1139: Revisiting Puzzle 91: Virus Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 15, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for Firebirds BioChem 21. Firebirds BioChem 1 pt. 6,423
  2. Avatar for DIE-CINVESTAV 22. DIE-CINVESTAV 1 pt. 5,707
  3. Avatar for Russian team 23. Russian team 1 pt. 3,306
  1. Avatar for val.sch67 171. val.sch67 Lv 1 1 pt. 7,565
  2. Avatar for pfeiffelfloyd 172. pfeiffelfloyd Lv 1 1 pt. 7,550
  3. Avatar for beta_particle 173. beta_particle Lv 1 1 pt. 7,545
  4. Avatar for IgorS 174. IgorS Lv 1 1 pt. 7,545
  5. Avatar for Vinara 175. Vinara Lv 1 1 pt. 7,540
  6. Avatar for JackONeill12 176. JackONeill12 Lv 1 1 pt. 7,535
  7. Avatar for rezaefar 177. rezaefar Lv 1 1 pt. 7,532
  8. Avatar for karost 178. karost Lv 1 1 pt. 7,521
  9. Avatar for oaks 179. oaks Lv 1 1 pt. 7,511
  10. Avatar for proteansoup 180. proteansoup Lv 1 1 pt. 7,506

Comments