Placeholder image of a protein
Icon representing a puzzle

1139: Revisiting Puzzle 91: Virus Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 15, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Firebirds BioChem 21. Firebirds BioChem 1 pt. 6,423
  2. Avatar for DIE-CINVESTAV 22. DIE-CINVESTAV 1 pt. 5,707
  3. Avatar for Russian team 23. Russian team 1 pt. 3,306

  1. Avatar for Crossed Sticks 231. Crossed Sticks Lv 1 1 pt. 6,976
  2. Avatar for basas 232. basas Lv 1 1 pt. 6,944
  3. Avatar for Jorge Cantero 233. Jorge Cantero Lv 1 1 pt. 6,936
  4. Avatar for Petrifolder 234. Petrifolder Lv 1 1 pt. 6,925
  5. Avatar for hogatejo 235. hogatejo Lv 1 1 pt. 6,914
  6. Avatar for Charlie_Sparkes 236. Charlie_Sparkes Lv 1 1 pt. 6,913
  7. Avatar for ENEMYAIR 237. ENEMYAIR Lv 1 1 pt. 6,867
  8. Avatar for Jaco van As 238. Jaco van As Lv 1 1 pt. 6,861
  9. Avatar for zgredek15 239. zgredek15 Lv 1 1 pt. 6,860
  10. Avatar for rennan42 240. rennan42 Lv 1 1 pt. 6,858

Comments