Placeholder image of a protein
Icon representing a puzzle

1139: Revisiting Puzzle 91: Virus Protein

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
September 15, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Firebirds BioChem 21. Firebirds BioChem 1 pt. 6,423
  2. Avatar for DIE-CINVESTAV 22. DIE-CINVESTAV 1 pt. 5,707
  3. Avatar for Russian team 23. Russian team 1 pt. 3,306

  1. Avatar for grogar7 41. grogar7 Lv 1 46 pts. 8,960
  2. Avatar for egran48 42. egran48 Lv 1 45 pts. 8,960
  3. Avatar for Museka 43. Museka Lv 1 44 pts. 8,960
  4. Avatar for Norrjane 44. Norrjane Lv 1 43 pts. 8,959
  5. Avatar for gurch 45. gurch Lv 1 42 pts. 8,958
  6. Avatar for nemo7731 46. nemo7731 Lv 1 41 pts. 8,957
  7. Avatar for smilingone 47. smilingone Lv 1 40 pts. 8,955
  8. Avatar for deLaCeiba 48. deLaCeiba Lv 1 40 pts. 8,935
  9. Avatar for pmthomson90 49. pmthomson90 Lv 1 39 pts. 8,930
  10. Avatar for christioanchauvin 50. christioanchauvin Lv 1 38 pts. 8,920

Comments