Placeholder image of a protein
Icon representing a puzzle

1139: Revisiting Puzzle 91: Virus Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 15, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Firebirds BioChem 21. Firebirds BioChem 1 pt. 6,423
  2. Avatar for DIE-CINVESTAV 22. DIE-CINVESTAV 1 pt. 5,707
  3. Avatar for Russian team 23. Russian team 1 pt. 3,306

  1. Avatar for Merf 71. Merf Lv 1 23 pts. 8,671
  2. Avatar for goastano 72. goastano Lv 1 23 pts. 8,658
  3. Avatar for drumpeter18yrs9yrs 73. drumpeter18yrs9yrs Lv 1 22 pts. 8,657
  4. Avatar for andrewxc 74. andrewxc Lv 1 22 pts. 8,650
  5. Avatar for ponderosa 75. ponderosa Lv 1 21 pts. 8,648
  6. Avatar for tallguy-13088 76. tallguy-13088 Lv 1 21 pts. 8,645
  7. Avatar for Deleted player 77. Deleted player pts. 8,638
  8. Avatar for TJOK fan 78. TJOK fan Lv 1 20 pts. 8,638
  9. Avatar for bendbob 79. bendbob Lv 1 19 pts. 8,637
  10. Avatar for Satina 80. Satina Lv 1 19 pts. 8,600

Comments