Placeholder image of a protein
Icon representing a puzzle

1139: Revisiting Puzzle 91: Virus Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 15, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,343
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 80 pts. 9,271
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,221
  4. Avatar for Go Science 4. Go Science 49 pts. 9,213
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 37 pts. 9,130
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 9,101
  7. Avatar for Contenders 7. Contenders 21 pts. 9,096
  8. Avatar for HMT heritage 8. HMT heritage 15 pts. 9,096
  9. Avatar for Deleted group 9. Deleted group pts. 9,059
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 9,031

  1. Avatar for alwen 11. alwen Lv 1 21 pts. 9,264
  2. Avatar for lamoille 12. lamoille Lv 1 18 pts. 9,256
  3. Avatar for jermainiac 13. jermainiac Lv 1 15 pts. 9,254
  4. Avatar for phi16 14. phi16 Lv 1 12 pts. 9,237
  5. Avatar for jamiexq 15. jamiexq Lv 1 10 pts. 9,230
  6. Avatar for Deleted player 16. Deleted player 8 pts. 9,220
  7. Avatar for smilingone 17. smilingone Lv 1 6 pts. 9,220
  8. Avatar for reefyrob 18. reefyrob Lv 1 5 pts. 9,218
  9. Avatar for Deleted player 19. Deleted player pts. 9,215
  10. Avatar for brgreening 20. brgreening Lv 1 3 pts. 9,214

Comments