Placeholder image of a protein
Icon representing a puzzle

1139: Revisiting Puzzle 91: Virus Protein

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
September 15, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,343
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 80 pts. 9,271
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,221
  4. Avatar for Go Science 4. Go Science 49 pts. 9,213
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 37 pts. 9,130
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 9,101
  7. Avatar for Contenders 7. Contenders 21 pts. 9,096
  8. Avatar for HMT heritage 8. HMT heritage 15 pts. 9,096
  9. Avatar for Deleted group 9. Deleted group pts. 9,059
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 9,031

  1. Avatar for dahast.de 121. dahast.de Lv 1 6 pts. 8,182
  2. Avatar for arginia 122. arginia Lv 1 6 pts. 8,179
  3. Avatar for senor pit 123. senor pit Lv 1 6 pts. 8,174
  4. Avatar for ManVsYard 124. ManVsYard Lv 1 6 pts. 8,172
  5. Avatar for actin19 125. actin19 Lv 1 5 pts. 8,160
  6. Avatar for MaartenDesnouck 126. MaartenDesnouck Lv 1 5 pts. 8,159
  7. Avatar for adamsuperktos 127. adamsuperktos Lv 1 5 pts. 8,158
  8. Avatar for Iron pet 128. Iron pet Lv 1 5 pts. 8,142
  9. Avatar for Hiro Protagonist 129. Hiro Protagonist Lv 1 5 pts. 8,135
  10. Avatar for brgreening 130. brgreening Lv 1 5 pts. 8,125

Comments