1139: Revisiting Puzzle 91: Virus Protein

Closed since over 10 years ago

Summary

• Created: September 15, 2015
• Expires: September 23, 2015 at 11:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

• 1. Gargleblasters 100 pts. 9,343
• 2. Anthropic Dreams 80 pts. 9,271
• 3. Beta Folders 63 pts. 9,221
• 4. Go Science 49 pts. 9,213
• 5. L'Alliance Francophone 37 pts. 9,130
• 6. Void Crushers 28 pts. 9,101
• 7. Contenders 21 pts. 9,096
• 8. HMT heritage 15 pts. 9,096
• 9. Deleted group pts. 9,059
• 10. Italiani Al Lavoro 8 pts. 9,031

Top soloists

• 51. martin.szew 37 pts. 8,914
• 52. cbwest 36 pts. 8,902
• 53. Tweedle Dumb 35 pts. 8,901
• 54. Anfinsen_slept_here 35 pts. 8,899
• 55. jermainiac 34 pts. 8,893
• 56. alcor29 33 pts. 8,888
• 57. t012 32 pts. 8,878
• 58. jobo0502 32 pts. 8,872
• 59. crpainter 31 pts. 8,862
• 60. Lindata 30 pts. 8,851