Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 9 pts. 9,107
  2. Avatar for BOINC@Poland 12. BOINC@Poland 7 pts. 8,803
  3. Avatar for xkcd 13. xkcd 5 pts. 8,564
  4. Avatar for Natural Abilities 14. Natural Abilities 4 pts. 8,148
  5. Avatar for Androids 15. Androids 3 pts. 7,710
  6. Avatar for Deleted group 16. Deleted group pts. 7,672
  7. Avatar for Rice Biochemistry 17. Rice Biochemistry 1 pt. 7,643
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 7,444
  9. Avatar for freefolder 19. freefolder 1 pt. 7,387
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,569
  1. Avatar for Hiro Protagonist 11. Hiro Protagonist Lv 1 83 pts. 9,283
  2. Avatar for johnmitch 12. johnmitch Lv 1 81 pts. 9,282
  3. Avatar for Deleted player 13. Deleted player 79 pts. 9,273
  4. Avatar for BitSpawn 14. BitSpawn Lv 1 78 pts. 9,272
  5. Avatar for smilingone 15. smilingone Lv 1 76 pts. 9,267
  6. Avatar for LociOiling 16. LociOiling Lv 1 75 pts. 9,264
  7. Avatar for egran48 17. egran48 Lv 1 73 pts. 9,257
  8. Avatar for pmdpmd 18. pmdpmd Lv 1 72 pts. 9,255
  9. Avatar for grogar7 19. grogar7 Lv 1 70 pts. 9,253
  10. Avatar for frood66 20. frood66 Lv 1 69 pts. 9,253

Comments