Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,356
  2. Avatar for Beta Folders 2. Beta Folders 83 pts. 9,348
  3. Avatar for Void Crushers 3. Void Crushers 68 pts. 9,306
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 55 pts. 9,305
  5. Avatar for Gargleblasters 5. Gargleblasters 44 pts. 9,297
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 35 pts. 9,291
  7. Avatar for Contenders 7. Contenders 27 pts. 9,285
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 21 pts. 9,283
  9. Avatar for Deleted group 9. Deleted group pts. 9,236
  10. Avatar for HMT heritage 10. HMT heritage 12 pts. 9,218
  1. Avatar for Hiro Protagonist 11. Hiro Protagonist Lv 1 83 pts. 9,283
  2. Avatar for johnmitch 12. johnmitch Lv 1 81 pts. 9,282
  3. Avatar for Deleted player 13. Deleted player 79 pts. 9,273
  4. Avatar for BitSpawn 14. BitSpawn Lv 1 78 pts. 9,272
  5. Avatar for smilingone 15. smilingone Lv 1 76 pts. 9,267
  6. Avatar for LociOiling 16. LociOiling Lv 1 75 pts. 9,264
  7. Avatar for egran48 17. egran48 Lv 1 73 pts. 9,257
  8. Avatar for pmdpmd 18. pmdpmd Lv 1 72 pts. 9,255
  9. Avatar for grogar7 19. grogar7 Lv 1 70 pts. 9,253
  10. Avatar for frood66 20. frood66 Lv 1 69 pts. 9,253

Comments