Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 9 pts. 9,107
  2. Avatar for BOINC@Poland 12. BOINC@Poland 7 pts. 8,803
  3. Avatar for xkcd 13. xkcd 5 pts. 8,564
  4. Avatar for Natural Abilities 14. Natural Abilities 4 pts. 8,148
  5. Avatar for Androids 15. Androids 3 pts. 7,710
  6. Avatar for Deleted group 16. Deleted group pts. 7,672
  7. Avatar for Rice Biochemistry 17. Rice Biochemistry 1 pt. 7,643
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 7,444
  9. Avatar for freefolder 19. freefolder 1 pt. 7,387
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,569
  1. Avatar for WonkyDonkey 61. WonkyDonkey Lv 1 27 pts. 8,962
  2. Avatar for jobo0502 62. jobo0502 Lv 1 26 pts. 8,960
  3. Avatar for dbuske 63. dbuske Lv 1 26 pts. 8,950
  4. Avatar for gurch 64. gurch Lv 1 25 pts. 8,939
  5. Avatar for ponderosa 65. ponderosa Lv 1 25 pts. 8,922
  6. Avatar for Merf 66. Merf Lv 1 24 pts. 8,898
  7. Avatar for Deleted player 67. Deleted player pts. 8,885
  8. Avatar for weitzen 68. weitzen Lv 1 23 pts. 8,864
  9. Avatar for shettler 69. shettler Lv 1 22 pts. 8,852
  10. Avatar for jdormaar 70. jdormaar Lv 1 22 pts. 8,847

Comments