Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,356
  2. Avatar for Beta Folders 2. Beta Folders 83 pts. 9,348
  3. Avatar for Void Crushers 3. Void Crushers 68 pts. 9,306
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 55 pts. 9,305
  5. Avatar for Gargleblasters 5. Gargleblasters 44 pts. 9,297
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 35 pts. 9,291
  7. Avatar for Contenders 7. Contenders 27 pts. 9,285
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 21 pts. 9,283
  9. Avatar for Deleted group 9. Deleted group pts. 9,236
  10. Avatar for HMT heritage 10. HMT heritage 12 pts. 9,218
  1. Avatar for WonkyDonkey 61. WonkyDonkey Lv 1 27 pts. 8,962
  2. Avatar for jobo0502 62. jobo0502 Lv 1 26 pts. 8,960
  3. Avatar for dbuske 63. dbuske Lv 1 26 pts. 8,950
  4. Avatar for gurch 64. gurch Lv 1 25 pts. 8,939
  5. Avatar for ponderosa 65. ponderosa Lv 1 25 pts. 8,922
  6. Avatar for Merf 66. Merf Lv 1 24 pts. 8,898
  7. Avatar for Deleted player 67. Deleted player pts. 8,885
  8. Avatar for weitzen 68. weitzen Lv 1 23 pts. 8,864
  9. Avatar for shettler 69. shettler Lv 1 22 pts. 8,852
  10. Avatar for jdormaar 70. jdormaar Lv 1 22 pts. 8,847

Comments