Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 6,356
  2. Avatar for EVHS AP Biology 22. EVHS AP Biology 1 pt. 6,236
  3. Avatar for Deleted group 23. Deleted group pts. 6,211
  4. Avatar for Deleted group 24. Deleted group pts. 6,098
  5. Avatar for CureCoin 25. CureCoin 1 pt. 6,025
  6. Avatar for LS Pro Folders 26. LS Pro Folders 1 pt. 6,025
  7. Avatar for Deleted group 27. Deleted group pts. 5,907
  1. Avatar for Museka 91. Museka Lv 1 12 pts. 8,620
  2. Avatar for ecali 92. ecali Lv 1 12 pts. 8,608
  3. Avatar for SKSbell 93. SKSbell Lv 1 12 pts. 8,583
  4. Avatar for fryguy 94. fryguy Lv 1 11 pts. 8,564
  5. Avatar for molleke 95. molleke Lv 1 11 pts. 8,560
  6. Avatar for froggs554 96. froggs554 Lv 1 11 pts. 8,525
  7. Avatar for marie.p 97. marie.p Lv 1 10 pts. 8,525
  8. Avatar for pandapharmd 98. pandapharmd Lv 1 10 pts. 8,454
  9. Avatar for TJOK fan 99. TJOK fan Lv 1 10 pts. 8,435
  10. Avatar for Mohambone 100. Mohambone Lv 1 9 pts. 8,429

Comments