Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 6,356
  2. Avatar for EVHS AP Biology 22. EVHS AP Biology 1 pt. 6,236
  3. Avatar for Deleted group 23. Deleted group pts. 6,211
  4. Avatar for Deleted group 24. Deleted group pts. 6,098
  5. Avatar for CureCoin 25. CureCoin 1 pt. 6,025
  6. Avatar for LS Pro Folders 26. LS Pro Folders 1 pt. 6,025
  7. Avatar for Deleted group 27. Deleted group pts. 5,907
  1. Avatar for JUMELLE54 111. JUMELLE54 Lv 1 7 pts. 8,203
  2. Avatar for 01010011111 112. 01010011111 Lv 1 7 pts. 8,198
  3. Avatar for Ernst Zundel 113. Ernst Zundel Lv 1 6 pts. 8,190
  4. Avatar for PrettyPony2001 114. PrettyPony2001 Lv 1 6 pts. 8,176
  5. Avatar for brgreening 115. brgreening Lv 1 6 pts. 8,158
  6. Avatar for harvardman 116. harvardman Lv 1 6 pts. 8,155
  7. Avatar for trebach 117. trebach Lv 1 6 pts. 8,151
  8. Avatar for Mr_Jolty 118. Mr_Jolty Lv 1 5 pts. 8,148
  9. Avatar for ManVsYard 119. ManVsYard Lv 1 5 pts. 8,144
  10. Avatar for rinze 120. rinze Lv 1 5 pts. 8,131

Comments