Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 6,356
  2. Avatar for EVHS AP Biology 22. EVHS AP Biology 1 pt. 6,236
  3. Avatar for Deleted group 23. Deleted group pts. 6,211
  4. Avatar for Deleted group 24. Deleted group pts. 6,098
  5. Avatar for CureCoin 25. CureCoin 1 pt. 6,025
  6. Avatar for LS Pro Folders 26. LS Pro Folders 1 pt. 6,025
  7. Avatar for Deleted group 27. Deleted group pts. 5,907
  1. Avatar for bwkittitas 121. bwkittitas Lv 1 5 pts. 8,129
  2. Avatar for Iron pet 122. Iron pet Lv 1 5 pts. 8,125
  3. Avatar for Bolo77 123. Bolo77 Lv 1 5 pts. 8,077
  4. Avatar for Vinara 124. Vinara Lv 1 4 pts. 8,071
  5. Avatar for ielia 125. ielia Lv 1 4 pts. 8,061
  6. Avatar for lamoille 126. lamoille Lv 1 4 pts. 8,028
  7. Avatar for actin19 127. actin19 Lv 1 4 pts. 8,026
  8. Avatar for Jajaboman 128. Jajaboman Lv 1 4 pts. 8,014
  9. Avatar for Colostomy EXPLOSION. 129. Colostomy EXPLOSION. Lv 1 4 pts. 8,009
  10. Avatar for tarimo 130. tarimo Lv 1 4 pts. 7,963

Comments