Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 6,356
  2. Avatar for EVHS AP Biology 22. EVHS AP Biology 1 pt. 6,236
  3. Avatar for Deleted group 23. Deleted group pts. 6,211
  4. Avatar for Deleted group 24. Deleted group pts. 6,098
  5. Avatar for CureCoin 25. CureCoin 1 pt. 6,025
  6. Avatar for LS Pro Folders 26. LS Pro Folders 1 pt. 6,025
  7. Avatar for Deleted group 27. Deleted group pts. 5,907
  1. Avatar for abiogenesis 131. abiogenesis Lv 1 4 pts. 7,961
  2. Avatar for NotJim99 132. NotJim99 Lv 1 3 pts. 7,957
  3. Avatar for rezaefar 133. rezaefar Lv 1 3 pts. 7,952
  4. Avatar for senor pit 134. senor pit Lv 1 3 pts. 7,925
  5. Avatar for lange 135. lange Lv 1 3 pts. 7,922
  6. Avatar for decbin 136. decbin Lv 1 3 pts. 7,900
  7. Avatar for jebbiek 137. jebbiek Lv 1 3 pts. 7,877
  8. Avatar for leehaggis 138. leehaggis Lv 1 3 pts. 7,856
  9. Avatar for inkycatz 139. inkycatz Lv 1 3 pts. 7,838
  10. Avatar for chris11sholtz 140. chris11sholtz Lv 1 3 pts. 7,820

Comments