Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 6,356
  2. Avatar for EVHS AP Biology 22. EVHS AP Biology 1 pt. 6,236
  3. Avatar for Deleted group 23. Deleted group pts. 6,211
  4. Avatar for Deleted group 24. Deleted group pts. 6,098
  5. Avatar for CureCoin 25. CureCoin 1 pt. 6,025
  6. Avatar for LS Pro Folders 26. LS Pro Folders 1 pt. 6,025
  7. Avatar for Deleted group 27. Deleted group pts. 5,907
  1. Avatar for oakwhiz 141. oakwhiz Lv 1 3 pts. 7,816
  2. Avatar for Pibeagles 142. Pibeagles Lv 1 2 pts. 7,814
  3. Avatar for Gaouenn 143. Gaouenn Lv 1 2 pts. 7,786
  4. Avatar for cherry39 144. cherry39 Lv 1 2 pts. 7,775
  5. Avatar for Maru67 145. Maru67 Lv 1 2 pts. 7,747
  6. Avatar for hada 146. hada Lv 1 2 pts. 7,722
  7. Avatar for PlagueRat 147. PlagueRat Lv 1 2 pts. 7,710
  8. Avatar for Inkedhands 148. Inkedhands Lv 1 2 pts. 7,706
  9. Avatar for DScott 149. DScott Lv 1 2 pts. 7,689
  10. Avatar for k_mortify 150. k_mortify Lv 1 2 pts. 7,689

Comments