Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 6,356
  2. Avatar for EVHS AP Biology 22. EVHS AP Biology 1 pt. 6,236
  3. Avatar for Deleted group 23. Deleted group pts. 6,211
  4. Avatar for Deleted group 24. Deleted group pts. 6,098
  5. Avatar for CureCoin 25. CureCoin 1 pt. 6,025
  6. Avatar for LS Pro Folders 26. LS Pro Folders 1 pt. 6,025
  7. Avatar for Deleted group 27. Deleted group pts. 5,907
  1. Avatar for Kevin Fialkowski 151. Kevin Fialkowski Lv 1 2 pts. 7,672
  2. Avatar for Sydefecks 152. Sydefecks Lv 1 2 pts. 7,667
  3. Avatar for SouperGenious 153. SouperGenious Lv 1 2 pts. 7,665
  4. Avatar for dahast.de 154. dahast.de Lv 1 2 pts. 7,645
  5. Avatar for jtrube1 155. jtrube1 Lv 1 2 pts. 7,644
  6. Avatar for raymondfang 156. raymondfang Lv 1 2 pts. 7,643
  7. Avatar for Alistair69 157. Alistair69 Lv 1 1 pt. 7,642
  8. Avatar for nitrobacter 158. nitrobacter Lv 1 1 pt. 7,630
  9. Avatar for tela 159. tela Lv 1 1 pt. 7,620
  10. Avatar for yalexey 160. yalexey Lv 1 1 pt. 7,597

Comments