Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 6,356
  2. Avatar for EVHS AP Biology 22. EVHS AP Biology 1 pt. 6,236
  3. Avatar for Deleted group 23. Deleted group pts. 6,211
  4. Avatar for Deleted group 24. Deleted group pts. 6,098
  5. Avatar for CureCoin 25. CureCoin 1 pt. 6,025
  6. Avatar for LS Pro Folders 26. LS Pro Folders 1 pt. 6,025
  7. Avatar for Deleted group 27. Deleted group pts. 5,907
  1. Avatar for GenVeers 221. GenVeers Lv 1 1 pt. 6,191
  2. Avatar for Gmac1500 222. Gmac1500 Lv 1 1 pt. 6,162
  3. Avatar for Tac1 223. Tac1 Lv 1 1 pt. 6,106
  4. Avatar for Akira_Willy_Williams 224. Akira_Willy_Williams Lv 1 1 pt. 6,098
  5. Avatar for cor2020 225. cor2020 Lv 1 1 pt. 6,081
  6. Avatar for LucasFernandes 226. LucasFernandes Lv 1 1 pt. 6,079
  7. Avatar for Mirthrill 227. Mirthrill Lv 1 1 pt. 6,068
  8. Avatar for smarthuman 228. smarthuman Lv 1 1 pt. 6,025
  9. Avatar for Devreugkx 229. Devreugkx Lv 1 1 pt. 6,025
  10. Avatar for momadoc 230. momadoc Lv 1 1 pt. 6,005

Comments