Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 6,356
  2. Avatar for EVHS AP Biology 22. EVHS AP Biology 1 pt. 6,236
  3. Avatar for Deleted group 23. Deleted group pts. 6,211
  4. Avatar for Deleted group 24. Deleted group pts. 6,098
  5. Avatar for CureCoin 25. CureCoin 1 pt. 6,025
  6. Avatar for LS Pro Folders 26. LS Pro Folders 1 pt. 6,025
  7. Avatar for Deleted group 27. Deleted group pts. 5,907
  1. Avatar for cassandraberry81897 251. cassandraberry81897 Lv 1 1 pt. 0
  2. Avatar for jermainiac 252. jermainiac Lv 1 1 pt. 0
  3. Avatar for agnairt 253. agnairt Lv 1 1 pt. 0
  4. Avatar for packer 254. packer Lv 1 1 pt. 0
  5. Avatar for andreysams 255. andreysams Lv 1 1 pt. 0
  6. Avatar for Antibrad 256. Antibrad Lv 1 1 pt. 0
  7. Avatar for clunneyonw 257. clunneyonw Lv 1 1 pt. 0
  8. Avatar for val.sch67 258. val.sch67 Lv 1 1 pt. 0
  9. Avatar for snft 259. snft Lv 1 1 pt. 0

Comments