Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 6,356
  2. Avatar for EVHS AP Biology 22. EVHS AP Biology 1 pt. 6,236
  3. Avatar for Deleted group 23. Deleted group pts. 6,211
  4. Avatar for Deleted group 24. Deleted group pts. 6,098
  5. Avatar for CureCoin 25. CureCoin 1 pt. 6,025
  6. Avatar for LS Pro Folders 26. LS Pro Folders 1 pt. 6,025
  7. Avatar for Deleted group 27. Deleted group pts. 5,907
  1. Avatar for Satina 41. Satina Lv 1 44 pts. 9,136
  2. Avatar for Paulo Roque 42. Paulo Roque Lv 1 43 pts. 9,130
  3. Avatar for g_b 43. g_b Lv 1 42 pts. 9,130
  4. Avatar for hansvandenhof 44. hansvandenhof Lv 1 41 pts. 9,128
  5. Avatar for christioanchauvin 45. christioanchauvin Lv 1 40 pts. 9,117
  6. Avatar for cobaltteal 46. cobaltteal Lv 1 39 pts. 9,112
  7. Avatar for pmthomson90 47. pmthomson90 Lv 1 38 pts. 9,107
  8. Avatar for DodoBird 48. DodoBird Lv 1 37 pts. 9,083
  9. Avatar for joremen 49. joremen Lv 1 36 pts. 9,080
  10. Avatar for WarpSpeed 50. WarpSpeed Lv 1 35 pts. 9,074

Comments