Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 6,356
  2. Avatar for EVHS AP Biology 22. EVHS AP Biology 1 pt. 6,236
  3. Avatar for Deleted group 23. Deleted group pts. 6,211
  4. Avatar for Deleted group 24. Deleted group pts. 6,098
  5. Avatar for CureCoin 25. CureCoin 1 pt. 6,025
  6. Avatar for LS Pro Folders 26. LS Pro Folders 1 pt. 6,025
  7. Avatar for Deleted group 27. Deleted group pts. 5,907
  1. Avatar for mimi 51. mimi Lv 1 35 pts. 9,070
  2. Avatar for silverberg 52. silverberg Lv 1 34 pts. 9,066
  3. Avatar for uhuuhu 53. uhuuhu Lv 1 33 pts. 9,066
  4. Avatar for goastano 54. goastano Lv 1 32 pts. 9,044
  5. Avatar for sheerbliss 55. sheerbliss Lv 1 31 pts. 9,041
  6. Avatar for TheGUmmer 56. TheGUmmer Lv 1 31 pts. 9,031
  7. Avatar for crpainter 57. crpainter Lv 1 30 pts. 8,994
  8. Avatar for t012 58. t012 Lv 1 29 pts. 8,990
  9. Avatar for martin.szew 59. martin.szew Lv 1 28 pts. 8,988
  10. Avatar for cbwest 60. cbwest Lv 1 28 pts. 8,976

Comments