Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 6,356
  2. Avatar for EVHS AP Biology 22. EVHS AP Biology 1 pt. 6,236
  3. Avatar for Deleted group 23. Deleted group pts. 6,211
  4. Avatar for Deleted group 24. Deleted group pts. 6,098
  5. Avatar for CureCoin 25. CureCoin 1 pt. 6,025
  6. Avatar for LS Pro Folders 26. LS Pro Folders 1 pt. 6,025
  7. Avatar for Deleted group 27. Deleted group pts. 5,907
  1. Avatar for TomTaylor 81. TomTaylor Lv 1 16 pts. 8,786
  2. Avatar for nemo7731 82. nemo7731 Lv 1 16 pts. 8,782
  3. Avatar for bendbob 83. bendbob Lv 1 15 pts. 8,768
  4. Avatar for tallguy-13088 84. tallguy-13088 Lv 1 15 pts. 8,764
  5. Avatar for andrewxc 85. andrewxc Lv 1 14 pts. 8,749
  6. Avatar for jamiexq 86. jamiexq Lv 1 14 pts. 8,729
  7. Avatar for Idiotboy 87. Idiotboy Lv 1 14 pts. 8,693
  8. Avatar for YeshuaLives 88. YeshuaLives Lv 1 13 pts. 8,656
  9. Avatar for pfirth 89. pfirth Lv 1 13 pts. 8,631
  10. Avatar for phi16 90. phi16 Lv 1 13 pts. 8,630

Comments