Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,356
  2. Avatar for Beta Folders 2. Beta Folders 83 pts. 9,348
  3. Avatar for Void Crushers 3. Void Crushers 68 pts. 9,306
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 55 pts. 9,305
  5. Avatar for Gargleblasters 5. Gargleblasters 44 pts. 9,297
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 35 pts. 9,291
  7. Avatar for Contenders 7. Contenders 27 pts. 9,285
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 21 pts. 9,283
  9. Avatar for Deleted group 9. Deleted group pts. 9,236
  10. Avatar for HMT heritage 10. HMT heritage 12 pts. 9,218
  1. Avatar for Crossed Sticks 31. Crossed Sticks Lv 1 54 pts. 9,202
  2. Avatar for Glen B 32. Glen B Lv 1 53 pts. 9,197
  3. Avatar for hpaege 33. hpaege Lv 1 52 pts. 9,191
  4. Avatar for Neil9 34. Neil9 Lv 1 51 pts. 9,175
  5. Avatar for Anfinsen_slept_here 35. Anfinsen_slept_here Lv 1 50 pts. 9,166
  6. Avatar for Norrjane 36. Norrjane Lv 1 49 pts. 9,156
  7. Avatar for dcrwheeler 37. dcrwheeler Lv 1 48 pts. 9,152
  8. Avatar for actiasluna 38. actiasluna Lv 1 47 pts. 9,152
  9. Avatar for pvc78 39. pvc78 Lv 1 46 pts. 9,151
  10. Avatar for viosca 40. viosca Lv 1 45 pts. 9,139

Comments