Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,784
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 5 pts. 8,740
  3. Avatar for BOINC@Poland 13. BOINC@Poland 4 pts. 8,593
  4. Avatar for Deleted group 14. Deleted group pts. 8,578
  5. Avatar for Natural Abilities 15. Natural Abilities 2 pts. 8,484
  6. Avatar for Russian team 16. Russian team 1 pt. 8,271
  7. Avatar for SHELL 17. SHELL 1 pt. 8,169
  8. Avatar for It's over 9000! 18. It's over 9000! 1 pt. 7,821
  9. Avatar for Minions of TWIS 19. Minions of TWIS 1 pt. 7,739
  10. Avatar for freefolder 20. freefolder 1 pt. 7,175

  1. Avatar for hada 121. hada Lv 1 4 pts. 8,225
  2. Avatar for ViJay7019 122. ViJay7019 Lv 1 4 pts. 8,221
  3. Avatar for andrewxc 123. andrewxc Lv 1 4 pts. 8,217
  4. Avatar for Festering Wounds 124. Festering Wounds Lv 1 4 pts. 8,215
  5. Avatar for pfeiffelfloyd 125. pfeiffelfloyd Lv 1 4 pts. 8,202
  6. Avatar for NameChangeNeeded01 126. NameChangeNeeded01 Lv 1 3 pts. 8,189
  7. Avatar for jebbiek 127. jebbiek Lv 1 3 pts. 8,180
  8. Avatar for chingsong 128. chingsong Lv 1 3 pts. 8,169
  9. Avatar for Iron pet 129. Iron pet Lv 1 3 pts. 8,155
  10. Avatar for leehaggis 130. leehaggis Lv 1 3 pts. 8,140

Comments