Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,784
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 5 pts. 8,740
  3. Avatar for BOINC@Poland 13. BOINC@Poland 4 pts. 8,593
  4. Avatar for Deleted group 14. Deleted group pts. 8,578
  5. Avatar for Natural Abilities 15. Natural Abilities 2 pts. 8,484
  6. Avatar for Russian team 16. Russian team 1 pt. 8,271
  7. Avatar for SHELL 17. SHELL 1 pt. 8,169
  8. Avatar for It's over 9000! 18. It's over 9000! 1 pt. 7,821
  9. Avatar for Minions of TWIS 19. Minions of TWIS 1 pt. 7,739
  10. Avatar for freefolder 20. freefolder 1 pt. 7,175
  1. Avatar for gmn 11. gmn Lv 1 82 pts. 9,018
  2. Avatar for WarpSpeed 12. WarpSpeed Lv 1 80 pts. 9,015
  3. Avatar for sheerbliss 13. sheerbliss Lv 1 78 pts. 9,006
  4. Avatar for mimi 14. mimi Lv 1 77 pts. 9,003
  5. Avatar for g_b 15. g_b Lv 1 75 pts. 8,998
  6. Avatar for Deleted player 16. Deleted player pts. 8,988
  7. Avatar for aznarog 17. aznarog Lv 1 72 pts. 8,978
  8. Avatar for Bruno Kestemont 18. Bruno Kestemont Lv 1 70 pts. 8,977
  9. Avatar for Timo van der Laan 19. Timo van der Laan Lv 1 69 pts. 8,974
  10. Avatar for pvc78 20. pvc78 Lv 1 67 pts. 8,956

Comments