Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for BCMB404-Fall2015 21. BCMB404-Fall2015 1 pt. 7,134
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,107
  3. Avatar for Penn State Biomolecular Engineers 23. Penn State Biomolecular Engineers 1 pt. 2,955
  4. Avatar for Rice Biochemistry 24. Rice Biochemistry 1 pt. 2,955
  5. Avatar for Window Group 25. Window Group 1 pt. 2,955
  1. Avatar for Vinara 141. Vinara Lv 1 2 pts. 7,966
  2. Avatar for harvardman 142. harvardman Lv 1 2 pts. 7,962
  3. Avatar for Mike Cassidy 143. Mike Cassidy Lv 1 2 pts. 7,947
  4. Avatar for rinze 144. rinze Lv 1 2 pts. 7,938
  5. Avatar for Simek 145. Simek Lv 1 2 pts. 7,937
  6. Avatar for AryehK 146. AryehK Lv 1 2 pts. 7,930
  7. Avatar for traal 147. traal Lv 1 2 pts. 7,930
  8. Avatar for actin19 148. actin19 Lv 1 2 pts. 7,904
  9. Avatar for Sydefecks 149. Sydefecks Lv 1 2 pts. 7,889
  10. Avatar for decbin 150. decbin Lv 1 1 pt. 7,876

Comments