Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,197
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 81 pts. 9,160
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,087
  4. Avatar for Beta Folders 4. Beta Folders 52 pts. 9,078
  5. Avatar for HMT heritage 5. HMT heritage 41 pts. 9,050
  6. Avatar for Contenders 6. Contenders 32 pts. 9,003
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 24 pts. 8,999
  8. Avatar for Void Crushers 8. Void Crushers 18 pts. 8,974
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 14 pts. 8,848
  10. Avatar for xkcd 10. xkcd 10 pts. 8,807
  1. Avatar for Vinara 141. Vinara Lv 1 2 pts. 7,966
  2. Avatar for harvardman 142. harvardman Lv 1 2 pts. 7,962
  3. Avatar for Mike Cassidy 143. Mike Cassidy Lv 1 2 pts. 7,947
  4. Avatar for rinze 144. rinze Lv 1 2 pts. 7,938
  5. Avatar for Simek 145. Simek Lv 1 2 pts. 7,937
  6. Avatar for AryehK 146. AryehK Lv 1 2 pts. 7,930
  7. Avatar for traal 147. traal Lv 1 2 pts. 7,930
  8. Avatar for actin19 148. actin19 Lv 1 2 pts. 7,904
  9. Avatar for Sydefecks 149. Sydefecks Lv 1 2 pts. 7,889
  10. Avatar for decbin 150. decbin Lv 1 1 pt. 7,876

Comments