Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for BCMB404-Fall2015 21. BCMB404-Fall2015 1 pt. 7,134
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,107
  3. Avatar for Penn State Biomolecular Engineers 23. Penn State Biomolecular Engineers 1 pt. 2,955
  4. Avatar for Rice Biochemistry 24. Rice Biochemistry 1 pt. 2,955
  5. Avatar for Window Group 25. Window Group 1 pt. 2,955
  1. Avatar for pandabearsecond 161. pandabearsecond Lv 1 1 pt. 7,800
  2. Avatar for WhityAngel 162. WhityAngel Lv 1 1 pt. 7,799
  3. Avatar for Wheeler22 163. Wheeler22 Lv 1 1 pt. 7,797
  4. Avatar for Gaouenn 164. Gaouenn Lv 1 1 pt. 7,745
  5. Avatar for gldisater 165. gldisater Lv 1 1 pt. 7,739
  6. Avatar for bamh 166. bamh Lv 1 1 pt. 7,739
  7. Avatar for pandapharmd 167. pandapharmd Lv 1 1 pt. 7,732
  8. Avatar for NotJim99 168. NotJim99 Lv 1 1 pt. 7,728
  9. Avatar for proteansoup 169. proteansoup Lv 1 1 pt. 7,726
  10. Avatar for DScott 170. DScott Lv 1 1 pt. 7,683

Comments