Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,197
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 81 pts. 9,160
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,087
  4. Avatar for Beta Folders 4. Beta Folders 52 pts. 9,078
  5. Avatar for HMT heritage 5. HMT heritage 41 pts. 9,050
  6. Avatar for Contenders 6. Contenders 32 pts. 9,003
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 24 pts. 8,999
  8. Avatar for Void Crushers 8. Void Crushers 18 pts. 8,974
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 14 pts. 8,848
  10. Avatar for xkcd 10. xkcd 10 pts. 8,807
  1. Avatar for pandabearsecond 161. pandabearsecond Lv 1 1 pt. 7,800
  2. Avatar for WhityAngel 162. WhityAngel Lv 1 1 pt. 7,799
  3. Avatar for Wheeler22 163. Wheeler22 Lv 1 1 pt. 7,797
  4. Avatar for Gaouenn 164. Gaouenn Lv 1 1 pt. 7,745
  5. Avatar for gldisater 165. gldisater Lv 1 1 pt. 7,739
  6. Avatar for bamh 166. bamh Lv 1 1 pt. 7,739
  7. Avatar for pandapharmd 167. pandapharmd Lv 1 1 pt. 7,732
  8. Avatar for NotJim99 168. NotJim99 Lv 1 1 pt. 7,728
  9. Avatar for proteansoup 169. proteansoup Lv 1 1 pt. 7,726
  10. Avatar for DScott 170. DScott Lv 1 1 pt. 7,683

Comments