Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for BCMB404-Fall2015 21. BCMB404-Fall2015 1 pt. 7,134
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,107
  3. Avatar for Penn State Biomolecular Engineers 23. Penn State Biomolecular Engineers 1 pt. 2,955
  4. Avatar for Rice Biochemistry 24. Rice Biochemistry 1 pt. 2,955
  5. Avatar for Window Group 25. Window Group 1 pt. 2,955
  1. Avatar for drodriguez41912 231. drodriguez41912 Lv 1 1 pt. 6,505
  2. Avatar for slofgren 232. slofgren Lv 1 1 pt. 6,410
  3. Avatar for jermainiac 233. jermainiac Lv 1 1 pt. 6,397
  4. Avatar for Adonaj 234. Adonaj Lv 1 1 pt. 6,369
  5. Avatar for zlny 235. zlny Lv 1 1 pt. 6,331
  6. Avatar for kaiteyspringer 236. kaiteyspringer Lv 1 1 pt. 6,201
  7. Avatar for cqd123123 237. cqd123123 Lv 1 1 pt. 6,178
  8. Avatar for PavaniD 238. PavaniD Lv 1 1 pt. 5,201
  9. Avatar for nanou35 239. nanou35 Lv 1 1 pt. 5,031
  10. Avatar for manu8170 240. manu8170 Lv 1 1 pt. 2,955

Comments