Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,197
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 81 pts. 9,160
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,087
  4. Avatar for Beta Folders 4. Beta Folders 52 pts. 9,078
  5. Avatar for HMT heritage 5. HMT heritage 41 pts. 9,050
  6. Avatar for Contenders 6. Contenders 32 pts. 9,003
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 24 pts. 8,999
  8. Avatar for Void Crushers 8. Void Crushers 18 pts. 8,974
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 14 pts. 8,848
  10. Avatar for xkcd 10. xkcd 10 pts. 8,807
  1. Avatar for drodriguez41912 231. drodriguez41912 Lv 1 1 pt. 6,505
  2. Avatar for slofgren 232. slofgren Lv 1 1 pt. 6,410
  3. Avatar for jermainiac 233. jermainiac Lv 1 1 pt. 6,397
  4. Avatar for Adonaj 234. Adonaj Lv 1 1 pt. 6,369
  5. Avatar for zlny 235. zlny Lv 1 1 pt. 6,331
  6. Avatar for kaiteyspringer 236. kaiteyspringer Lv 1 1 pt. 6,201
  7. Avatar for cqd123123 237. cqd123123 Lv 1 1 pt. 6,178
  8. Avatar for PavaniD 238. PavaniD Lv 1 1 pt. 5,201
  9. Avatar for nanou35 239. nanou35 Lv 1 1 pt. 5,031
  10. Avatar for manu8170 240. manu8170 Lv 1 1 pt. 2,955

Comments