Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for BCMB404-Fall2015 21. BCMB404-Fall2015 1 pt. 7,134
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,107
  3. Avatar for Penn State Biomolecular Engineers 23. Penn State Biomolecular Engineers 1 pt. 2,955
  4. Avatar for Rice Biochemistry 24. Rice Biochemistry 1 pt. 2,955
  5. Avatar for Window Group 25. Window Group 1 pt. 2,955
  1. Avatar for gloverd 31. gloverd Lv 1 53 pts. 8,905
  2. Avatar for brow42 32. brow42 Lv 1 51 pts. 8,904
  3. Avatar for viosca 33. viosca Lv 1 50 pts. 8,896
  4. Avatar for Galaxie 34. Galaxie Lv 1 49 pts. 8,890
  5. Avatar for Bletchley Park 35. Bletchley Park Lv 1 48 pts. 8,873
  6. Avatar for christioanchauvin 36. christioanchauvin Lv 1 47 pts. 8,865
  7. Avatar for deLaCeiba 37. deLaCeiba Lv 1 46 pts. 8,848
  8. Avatar for Idiotboy 38. Idiotboy Lv 1 45 pts. 8,842
  9. Avatar for nemo7731 39. nemo7731 Lv 1 44 pts. 8,836
  10. Avatar for Paulo Roque 40. Paulo Roque Lv 1 43 pts. 8,829

Comments