Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,197
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 81 pts. 9,160
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,087
  4. Avatar for Beta Folders 4. Beta Folders 52 pts. 9,078
  5. Avatar for HMT heritage 5. HMT heritage 41 pts. 9,050
  6. Avatar for Contenders 6. Contenders 32 pts. 9,003
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 24 pts. 8,999
  8. Avatar for Void Crushers 8. Void Crushers 18 pts. 8,974
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 14 pts. 8,848
  10. Avatar for xkcd 10. xkcd 10 pts. 8,807
  1. Avatar for RathjeF 201. RathjeF Lv 1 1 pt. 7,295
  2. Avatar for kinnom 202. kinnom Lv 1 1 pt. 7,258
  3. Avatar for varjo1 203. varjo1 Lv 1 1 pt. 7,238
  4. Avatar for momoti2501 204. momoti2501 Lv 1 1 pt. 7,235
  5. Avatar for bhinger123 205. bhinger123 Lv 1 1 pt. 7,217
  6. Avatar for trentis1 206. trentis1 Lv 1 1 pt. 7,200
  7. Avatar for irenagrocka 207. irenagrocka Lv 1 1 pt. 7,186
  8. Avatar for Bolo77 208. Bolo77 Lv 1 1 pt. 7,183
  9. Avatar for Altercomp 209. Altercomp Lv 1 1 pt. 7,175
  10. Avatar for perrystaff 210. perrystaff Lv 1 1 pt. 7,169

Comments