Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 8 pts. 8,998
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 6 pts. 8,971
  3. Avatar for BOINC@Poland 13. BOINC@Poland 4 pts. 8,955
  4. Avatar for xkcd 14. xkcd 3 pts. 8,902
  5. Avatar for BCMB404-Fall2015 15. BCMB404-Fall2015 2 pts. 8,730
  6. Avatar for Androids 16. Androids 2 pts. 8,715
  7. Avatar for freefolder 17. freefolder 1 pt. 8,662
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,590
  9. Avatar for Natural Abilities 19. Natural Abilities 1 pt. 8,563
  10. Avatar for ROMANIA Team 20. ROMANIA Team 1 pt. 8,190

  1. Avatar for gloverd
    1. gloverd Lv 1
    100 pts. 9,328
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 90 pts. 9,328
  3. Avatar for mirp 3. mirp Lv 1 80 pts. 9,325
  4. Avatar for Paulo Roque 4. Paulo Roque Lv 1 71 pts. 9,322
  5. Avatar for actiasluna 5. actiasluna Lv 1 63 pts. 9,301
  6. Avatar for Blipperman 6. Blipperman Lv 1 55 pts. 9,295
  7. Avatar for ManVsYard 7. ManVsYard Lv 1 49 pts. 9,289
  8. Avatar for Skippysk8s 8. Skippysk8s Lv 1 43 pts. 9,287
  9. Avatar for frood66 9. frood66 Lv 1 37 pts. 9,284
  10. Avatar for smilingone 10. smilingone Lv 1 32 pts. 9,278

Comments