Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 8 pts. 8,998
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 6 pts. 8,971
  3. Avatar for BOINC@Poland 13. BOINC@Poland 4 pts. 8,955
  4. Avatar for xkcd 14. xkcd 3 pts. 8,902
  5. Avatar for BCMB404-Fall2015 15. BCMB404-Fall2015 2 pts. 8,730
  6. Avatar for Androids 16. Androids 2 pts. 8,715
  7. Avatar for freefolder 17. freefolder 1 pt. 8,662
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,590
  9. Avatar for Natural Abilities 19. Natural Abilities 1 pt. 8,563
  10. Avatar for ROMANIA Team 20. ROMANIA Team 1 pt. 8,190

  1. Avatar for gloverd
    1. gloverd Lv 1
    100 pts. 9,328
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 90 pts. 9,328
  3. Avatar for mirp 3. mirp Lv 1 80 pts. 9,325
  4. Avatar for Paulo Roque 4. Paulo Roque Lv 1 71 pts. 9,322
  5. Avatar for actiasluna 5. actiasluna Lv 1 63 pts. 9,301
  6. Avatar for Blipperman 6. Blipperman Lv 1 55 pts. 9,295
  7. Avatar for ManVsYard 7. ManVsYard Lv 1 49 pts. 9,289
  8. Avatar for Skippysk8s 8. Skippysk8s Lv 1 43 pts. 9,287
  9. Avatar for frood66 9. frood66 Lv 1 37 pts. 9,284
  10. Avatar for smilingone 10. smilingone Lv 1 32 pts. 9,278

Comments