Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,328
  2. Avatar for Gargleblasters 2. Gargleblasters 82 pts. 9,301
  3. Avatar for Beta Folders 3. Beta Folders 66 pts. 9,278
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 53 pts. 9,259
  5. Avatar for Contenders 5. Contenders 42 pts. 9,208
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 33 pts. 9,185
  7. Avatar for Russian team 7. Russian team 26 pts. 9,096
  8. Avatar for Void Crushers 8. Void Crushers 20 pts. 9,069
  9. Avatar for Deleted group 9. Deleted group pts. 9,062
  10. Avatar for HMT heritage 10. HMT heritage 11 pts. 9,046
  1. Avatar for egran48
    1. egran48 Lv 1
    100 pts. 9,324
  2. Avatar for Skippysk8s 2. Skippysk8s Lv 1 99 pts. 9,278
  3. Avatar for mirp 3. mirp Lv 1 97 pts. 9,270
  4. Avatar for gloverd 4. gloverd Lv 1 95 pts. 9,268
  5. Avatar for bertro 5. bertro Lv 1 93 pts. 9,258
  6. Avatar for frood66 6. frood66 Lv 1 92 pts. 9,250
  7. Avatar for retiredmichael 7. retiredmichael Lv 1 90 pts. 9,240
  8. Avatar for johnmitch 8. johnmitch Lv 1 88 pts. 9,236
  9. Avatar for viosca 9. viosca Lv 1 87 pts. 9,234
  10. Avatar for LociOiling 10. LociOiling Lv 1 85 pts. 9,230

Comments