Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 8 pts. 8,998
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 6 pts. 8,971
  3. Avatar for BOINC@Poland 13. BOINC@Poland 4 pts. 8,955
  4. Avatar for xkcd 14. xkcd 3 pts. 8,902
  5. Avatar for BCMB404-Fall2015 15. BCMB404-Fall2015 2 pts. 8,730
  6. Avatar for Androids 16. Androids 2 pts. 8,715
  7. Avatar for freefolder 17. freefolder 1 pt. 8,662
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,590
  9. Avatar for Natural Abilities 19. Natural Abilities 1 pt. 8,563
  10. Avatar for ROMANIA Team 20. ROMANIA Team 1 pt. 8,190

  1. Avatar for Crossed Sticks 101. Crossed Sticks Lv 1 11 pts. 8,791
  2. Avatar for froggs554 102. froggs554 Lv 1 11 pts. 8,791
  3. Avatar for jebbiek 103. jebbiek Lv 1 10 pts. 8,787
  4. Avatar for Deleted player 104. Deleted player pts. 8,786
  5. Avatar for YeshuaLives 105. YeshuaLives Lv 1 10 pts. 8,783
  6. Avatar for senor pit 106. senor pit Lv 1 10 pts. 8,774
  7. Avatar for drumpeter18yrs9yrs 107. drumpeter18yrs9yrs Lv 1 9 pts. 8,772
  8. Avatar for pfirth 108. pfirth Lv 1 9 pts. 8,767
  9. Avatar for Gaouenn 109. Gaouenn Lv 1 9 pts. 8,767
  10. Avatar for Mark- 110. Mark- Lv 1 9 pts. 8,760

Comments