Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 8 pts. 8,998
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 6 pts. 8,971
  3. Avatar for BOINC@Poland 13. BOINC@Poland 4 pts. 8,955
  4. Avatar for xkcd 14. xkcd 3 pts. 8,902
  5. Avatar for BCMB404-Fall2015 15. BCMB404-Fall2015 2 pts. 8,730
  6. Avatar for Androids 16. Androids 2 pts. 8,715
  7. Avatar for freefolder 17. freefolder 1 pt. 8,662
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,590
  9. Avatar for Natural Abilities 19. Natural Abilities 1 pt. 8,563
  10. Avatar for ROMANIA Team 20. ROMANIA Team 1 pt. 8,190

  1. Avatar for Bushman 111. Bushman Lv 1 8 pts. 8,759
  2. Avatar for molleke 112. molleke Lv 1 8 pts. 8,756
  3. Avatar for lamoille 113. lamoille Lv 1 8 pts. 8,750
  4. Avatar for Soggy Doglog 114. Soggy Doglog Lv 1 8 pts. 8,747
  5. Avatar for johngran 115. johngran Lv 1 7 pts. 8,747
  6. Avatar for szymos249 116. szymos249 Lv 1 7 pts. 8,745
  7. Avatar for Merf 117. Merf Lv 1 7 pts. 8,734
  8. Avatar for atlas100 118. atlas100 Lv 1 7 pts. 8,731
  9. Avatar for raafay 119. raafay Lv 1 7 pts. 8,730
  10. Avatar for phi16 120. phi16 Lv 1 6 pts. 8,721

Comments