Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 8 pts. 8,998
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 6 pts. 8,971
  3. Avatar for BOINC@Poland 13. BOINC@Poland 4 pts. 8,955
  4. Avatar for xkcd 14. xkcd 3 pts. 8,902
  5. Avatar for BCMB404-Fall2015 15. BCMB404-Fall2015 2 pts. 8,730
  6. Avatar for Androids 16. Androids 2 pts. 8,715
  7. Avatar for freefolder 17. freefolder 1 pt. 8,662
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,590
  9. Avatar for Natural Abilities 19. Natural Abilities 1 pt. 8,563
  10. Avatar for ROMANIA Team 20. ROMANIA Team 1 pt. 8,190

  1. Avatar for gmn 11. gmn Lv 1 84 pts. 9,216
  2. Avatar for mimi 12. mimi Lv 1 82 pts. 9,202
  3. Avatar for BitSpawn 13. BitSpawn Lv 1 81 pts. 9,202
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 79 pts. 9,195
  5. Avatar for Vredeman 15. Vredeman Lv 1 78 pts. 9,195
  6. Avatar for sheerbliss 16. sheerbliss Lv 1 76 pts. 9,194
  7. Avatar for hpaege 17. hpaege Lv 1 75 pts. 9,192
  8. Avatar for nicobul 18. nicobul Lv 1 73 pts. 9,185
  9. Avatar for pauldunn 19. pauldunn Lv 1 72 pts. 9,177
  10. Avatar for aznarog 20. aznarog Lv 1 70 pts. 9,166

Comments