rosieyhdr Lv 1
teach me how to play
Closed since over 10 years ago
Intermediate Intermediate Overall Overall Prediction PredictionThis is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE