Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 8 pts. 8,998
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 6 pts. 8,971
  3. Avatar for BOINC@Poland 13. BOINC@Poland 4 pts. 8,955
  4. Avatar for xkcd 14. xkcd 3 pts. 8,902
  5. Avatar for BCMB404-Fall2015 15. BCMB404-Fall2015 2 pts. 8,730
  6. Avatar for Androids 16. Androids 2 pts. 8,715
  7. Avatar for freefolder 17. freefolder 1 pt. 8,662
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,590
  9. Avatar for Natural Abilities 19. Natural Abilities 1 pt. 8,563
  10. Avatar for ROMANIA Team 20. ROMANIA Team 1 pt. 8,190

  1. Avatar for franzemanz 241. franzemanz Lv 1 1 pt. 7,927
  2. Avatar for avoe3 242. avoe3 Lv 1 1 pt. 7,918
  3. Avatar for AryehK 243. AryehK Lv 1 1 pt. 7,886
  4. Avatar for MatthewAcosta 244. MatthewAcosta Lv 1 1 pt. 7,868
  5. Avatar for Brocast Reggie 245. Brocast Reggie Lv 1 1 pt. 7,854
  6. Avatar for milkymaniac 246. milkymaniac Lv 1 1 pt. 7,853
  7. Avatar for Close At Hand 247. Close At Hand Lv 1 1 pt. 7,814
  8. Avatar for tryedward 248. tryedward Lv 1 1 pt. 7,800
  9. Avatar for Kurttobin 249. Kurttobin Lv 1 1 pt. 7,755
  10. Avatar for magmalm 250. magmalm Lv 1 1 pt. 7,688

Comments