Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 8 pts. 8,998
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 6 pts. 8,971
  3. Avatar for BOINC@Poland 13. BOINC@Poland 4 pts. 8,955
  4. Avatar for xkcd 14. xkcd 3 pts. 8,902
  5. Avatar for BCMB404-Fall2015 15. BCMB404-Fall2015 2 pts. 8,730
  6. Avatar for Androids 16. Androids 2 pts. 8,715
  7. Avatar for freefolder 17. freefolder 1 pt. 8,662
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,590
  9. Avatar for Natural Abilities 19. Natural Abilities 1 pt. 8,563
  10. Avatar for ROMANIA Team 20. ROMANIA Team 1 pt. 8,190

  1. Avatar for Galaxie 31. Galaxie Lv 1 57 pts. 9,124
  2. Avatar for cbwest 32. cbwest Lv 1 55 pts. 9,119
  3. Avatar for Mark A 33. Mark A Lv 1 54 pts. 9,119
  4. Avatar for TomTaylor 34. TomTaylor Lv 1 53 pts. 9,110
  5. Avatar for Grom 35. Grom Lv 1 52 pts. 9,096
  6. Avatar for actiasluna 36. actiasluna Lv 1 51 pts. 9,096
  7. Avatar for Tweedle Dumb 37. Tweedle Dumb Lv 1 50 pts. 9,095
  8. Avatar for Deleted player 38. Deleted player 49 pts. 9,093
  9. Avatar for Paulo Roque 39. Paulo Roque Lv 1 48 pts. 9,081
  10. Avatar for weitzen 40. weitzen Lv 1 47 pts. 9,070

Comments