Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 8 pts. 8,998
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 6 pts. 8,971
  3. Avatar for BOINC@Poland 13. BOINC@Poland 4 pts. 8,955
  4. Avatar for xkcd 14. xkcd 3 pts. 8,902
  5. Avatar for BCMB404-Fall2015 15. BCMB404-Fall2015 2 pts. 8,730
  6. Avatar for Androids 16. Androids 2 pts. 8,715
  7. Avatar for freefolder 17. freefolder 1 pt. 8,662
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,590
  9. Avatar for Natural Abilities 19. Natural Abilities 1 pt. 8,563
  10. Avatar for ROMANIA Team 20. ROMANIA Team 1 pt. 8,190

  1. Avatar for uhuuhu 41. uhuuhu Lv 1 46 pts. 9,069
  2. Avatar for diamond_dust 42. diamond_dust Lv 1 45 pts. 9,065
  3. Avatar for joremen 43. joremen Lv 1 44 pts. 9,065
  4. Avatar for christioanchauvin 44. christioanchauvin Lv 1 43 pts. 9,063
  5. Avatar for Anfinsen_slept_here 45. Anfinsen_slept_here Lv 1 42 pts. 9,062
  6. Avatar for pmdpmd 46. pmdpmd Lv 1 41 pts. 9,055
  7. Avatar for pvc78 47. pvc78 Lv 1 41 pts. 9,054
  8. Avatar for Museka 48. Museka Lv 1 40 pts. 9,050
  9. Avatar for dcrwheeler 49. dcrwheeler Lv 1 39 pts. 9,047
  10. Avatar for O Seki To 50. O Seki To Lv 1 38 pts. 9,046

Comments