Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 8 pts. 8,998
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 6 pts. 8,971
  3. Avatar for BOINC@Poland 13. BOINC@Poland 4 pts. 8,955
  4. Avatar for xkcd 14. xkcd 3 pts. 8,902
  5. Avatar for BCMB404-Fall2015 15. BCMB404-Fall2015 2 pts. 8,730
  6. Avatar for Androids 16. Androids 2 pts. 8,715
  7. Avatar for freefolder 17. freefolder 1 pt. 8,662
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,590
  9. Avatar for Natural Abilities 19. Natural Abilities 1 pt. 8,563
  10. Avatar for ROMANIA Team 20. ROMANIA Team 1 pt. 8,190

  1. Avatar for cobaltteal 51. cobaltteal Lv 1 37 pts. 9,038
  2. Avatar for MaartenDesnouck 52. MaartenDesnouck Lv 1 36 pts. 9,028
  3. Avatar for Timo van der Laan 53. Timo van der Laan Lv 1 36 pts. 9,025
  4. Avatar for SKSbell 54. SKSbell Lv 1 35 pts. 9,004
  5. Avatar for pmthomson90 55. pmthomson90 Lv 1 34 pts. 8,998
  6. Avatar for hansvandenhof 56. hansvandenhof Lv 1 33 pts. 8,993
  7. Avatar for mitarcher 57. mitarcher Lv 1 33 pts. 8,989
  8. Avatar for shettler 58. shettler Lv 1 32 pts. 8,987
  9. Avatar for dbuske 59. dbuske Lv 1 31 pts. 8,986
  10. Avatar for Hiro Protagonist 60. Hiro Protagonist Lv 1 30 pts. 8,971

Comments