Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 8 pts. 8,998
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 6 pts. 8,971
  3. Avatar for BOINC@Poland 13. BOINC@Poland 4 pts. 8,955
  4. Avatar for xkcd 14. xkcd 3 pts. 8,902
  5. Avatar for BCMB404-Fall2015 15. BCMB404-Fall2015 2 pts. 8,730
  6. Avatar for Androids 16. Androids 2 pts. 8,715
  7. Avatar for freefolder 17. freefolder 1 pt. 8,662
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,590
  9. Avatar for Natural Abilities 19. Natural Abilities 1 pt. 8,563
  10. Avatar for ROMANIA Team 20. ROMANIA Team 1 pt. 8,190

  1. Avatar for cobaltteal 51. cobaltteal Lv 1 37 pts. 9,038
  2. Avatar for MaartenDesnouck 52. MaartenDesnouck Lv 1 36 pts. 9,028
  3. Avatar for Timo van der Laan 53. Timo van der Laan Lv 1 36 pts. 9,025
  4. Avatar for SKSbell 54. SKSbell Lv 1 35 pts. 9,004
  5. Avatar for pmthomson90 55. pmthomson90 Lv 1 34 pts. 8,998
  6. Avatar for hansvandenhof 56. hansvandenhof Lv 1 33 pts. 8,993
  7. Avatar for mitarcher 57. mitarcher Lv 1 33 pts. 8,989
  8. Avatar for shettler 58. shettler Lv 1 32 pts. 8,987
  9. Avatar for dbuske 59. dbuske Lv 1 31 pts. 8,986
  10. Avatar for Hiro Protagonist 60. Hiro Protagonist Lv 1 30 pts. 8,971

Comments