Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 8 pts. 8,998
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 6 pts. 8,971
  3. Avatar for BOINC@Poland 13. BOINC@Poland 4 pts. 8,955
  4. Avatar for xkcd 14. xkcd 3 pts. 8,902
  5. Avatar for BCMB404-Fall2015 15. BCMB404-Fall2015 2 pts. 8,730
  6. Avatar for Androids 16. Androids 2 pts. 8,715
  7. Avatar for freefolder 17. freefolder 1 pt. 8,662
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,590
  9. Avatar for Natural Abilities 19. Natural Abilities 1 pt. 8,563
  10. Avatar for ROMANIA Team 20. ROMANIA Team 1 pt. 8,190

  1. Avatar for JackONeill12 71. JackONeill12 Lv 1 24 pts. 8,910
  2. Avatar for ponderosa 72. ponderosa Lv 1 23 pts. 8,903
  3. Avatar for fryguy 73. fryguy Lv 1 22 pts. 8,902
  4. Avatar for goastano 74. goastano Lv 1 22 pts. 8,902
  5. Avatar for caglar 75. caglar Lv 1 21 pts. 8,900
  6. Avatar for gurch 76. gurch Lv 1 21 pts. 8,896
  7. Avatar for sharondipity 77. sharondipity Lv 1 20 pts. 8,896
  8. Avatar for dettingen 78. dettingen Lv 1 20 pts. 8,891
  9. Avatar for tallguy-13088 79. tallguy-13088 Lv 1 19 pts. 8,883
  10. Avatar for Idiotboy 80. Idiotboy Lv 1 19 pts. 8,883

Comments