Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 8 pts. 8,998
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 6 pts. 8,971
  3. Avatar for BOINC@Poland 13. BOINC@Poland 4 pts. 8,955
  4. Avatar for xkcd 14. xkcd 3 pts. 8,902
  5. Avatar for BCMB404-Fall2015 15. BCMB404-Fall2015 2 pts. 8,730
  6. Avatar for Androids 16. Androids 2 pts. 8,715
  7. Avatar for freefolder 17. freefolder 1 pt. 8,662
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,590
  9. Avatar for Natural Abilities 19. Natural Abilities 1 pt. 8,563
  10. Avatar for ROMANIA Team 20. ROMANIA Team 1 pt. 8,190

  1. Avatar for jermainiac 81. jermainiac Lv 1 18 pts. 8,875
  2. Avatar for greepski 82. greepski Lv 1 18 pts. 8,871
  3. Avatar for Bletchley Park 83. Bletchley Park Lv 1 18 pts. 8,870
  4. Avatar for stomjoh 84. stomjoh Lv 1 17 pts. 8,856
  5. Avatar for Mike Cassidy 85. Mike Cassidy Lv 1 17 pts. 8,855
  6. Avatar for hada 86. hada Lv 1 16 pts. 8,854
  7. Avatar for deLaCeiba 87. deLaCeiba Lv 1 16 pts. 8,843
  8. Avatar for ncameron 88. ncameron Lv 1 15 pts. 8,840
  9. Avatar for guineapig 89. guineapig Lv 1 15 pts. 8,839
  10. Avatar for bwkittitas 90. bwkittitas Lv 1 15 pts. 8,833

Comments